99%+ Purity Guarantee

Undergoes independent third-party verification before release. Tested to confirm ≥99% purity.

Buy PNC-27 (5mg) Online

Name: PNC-27 (5mg)
Brand: NOVERA COMPOUNDS
Availability: InStock

Coming Soon

PNC-27 is a synthetic peptide studied for its interaction with cell membrane signaling in oncology-related research. Research suggests that it may influence cellular apoptosis mechanisms, primarily through interactions with membrane-associated pathways involved in cell cycle regulation.

General info

Brand	NOVERA COMPOUNDS
Strength	5mg
CAS	N/A
Chemical Formula	C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular weight	4031.7 g/mol
Peptide Sequence	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Synonyms	PNC‑27; p53(12–26)–penetratin/MRP chimera; HDM2‑targeted lytic peptide
Storage	Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Disclaimer: Sold as a research-grade lyophilized peptide in dry powder form. Requires reconstitution under controlled laboratory conditions. Reconstitution agents are not included.

For Research Use Only (RUO): Not for human or animal use, consumption, injection, or application. Not for diagnostic, therapeutic, or clinical purposes.

Buy More Peptides for Research Buy More Oncology Peptides Products

Free Shipping Over $1000

With fast order dispatch

Guaranteed Product Authenticity

All products contain original LOT numbers

Secure SSL
Encryption

Your data is safe with us

No Order
Minimum

Get the exact quantity you need.

Why Novera Compounds?

Precision-Synthesized Peptides

Advanced synthesis techniques ensure high structural fidelity and ≥99% purity.

Third-Party Verified Quality:

Independent laboratories confirm identity, purity, and batch consistency.

Research-Grade Reliability:

Designed for reproducible laboratory and analytical applications.

Strict Regulatory Compliance:

Products meet Research Use Only (RUO) standards and relevant laboratory regulations.

Documented Transparency:

Certificates of Analysis and quality verification reports provided for every lot.

555a76c773c8ed79615174887299fb4c5c66d2ad

PNC-27 (5mg) About This Product

PNC-27 (5mg) is a synthetic peptide composed of a p53-HDM-2 binding domain corresponding to residues 12–26 of the p53 tumor suppressor protein, combined with a membrane-targeting sequence to support cellular interaction in laboratory models. The PNC-27 peptide has a molecular weight of 4,031.7 Daltons (approximately 4.0 kDa) and molecular formula C₁₈₈H₂₉₃N₅₃O₄₄S. It is produced through solid-phase peptide synthesis to support consistency and structural integrity.

This product is supplied as a high-purity, lyophilized powder in a sealed research vial. In published preclinical literature, PNC-27 is used as a mechanistic research tool to investigate HDM-2/MDM2 membrane-associated behavior and peptide interaction patterns in experimental systems. Observations are specific to the experimental models used, such as in-vitro cell systems or isolated membrane preparations, and should be interpreted only within that context.

PNC-27 (5mg) Key Features and Benefits

High-purity synthetic peptide suitable for laboratory research
Supplied as a 5 mg lyophilized powder in a sealed vial
Studied in laboratory research for investigating tumor-selective interactions with cancer cell membranes
Peptide sequence includes a p53-derived HDM-2 binding domain
Suitable for in vitro and preclinical research applications
Stable under recommended cold-storage conditions
Commonly included in research workflows where laboratories buy PNC-27 peptide for controlled experimental use
For laboratory research use only

PNC-27 (5mg) Mechanism & Research Applications

PNC-27 is being investigated as a mechanistic probe to study peptide–HDM-2/MDM2 binding behavior and membrane-associated localization phenomena. Research focuses on how the peptide associates with HDM-2-related targets expressed on cancer cell membranes, leading to selective interactions under controlled laboratory conditions.

Research applications focus on examining peptide–protein binding interactions involving HDM-2/MDM2-associated motifs, assessing peptide localization to membrane compartments, and investigating selective pore formation and membrane destabilization in cancer cell models. Studies explore structure–function relationships within the p53-derived binding region using controlled experimental formats. Research also examines peptide-induced signaling mechanisms and apoptotic pathways in experimental cancer cell systems.

Experimental approaches commonly employed include peptide–protein binding assays, microscopy-based localization studies, biochemical membrane fractionation methods, and structure–function analysis frameworks designed to characterize p53-derived interaction domains.

PNC-27 (5mg) Dosing & Observed Effects in Research

Published research involving PNC-27 describes a range of experimental concentrations that vary by study design, cell type, and exposure duration. Dosing is commonly expressed as micromolar concentrations and applied in vitro to evaluate peptide–HDM-2 binding behavior and membrane localization patterns under controlled laboratory conditions.

Observed endpoints include binding readouts, localization signals, membrane-interaction signatures, and changes in cellular morphology or viability markers, measured using established laboratory assays. These findings support further mechanistic investigation rather than clinical interpretation. Laboratories that order PNC-27 peptide use these data to refine experimental design and comparative analysis.

PNC-27 (5mg) Storage, Safety & References

PNC-27 (5mg) should be stored in its lyophilized form at –20°C or lower, protected from light and moisture. Reconstituted solutions should be prepared using sterile laboratory techniques and aliquoted to limit repeated freeze–thaw cycles.

This product is intended for use by trained research personnel in controlled laboratory environments and should be handled according to standard laboratory safety procedures and institutional research guidelines.