Buy Cagrilintide 5mg Online

Cagrilintide is a long-acting amylin receptor agonist examined in metabolic and appetite-regulation research. Research suggests it influences satiety and gastric emptying through amylin receptor signaling, supporting studies of appetite control and energy regulation. It is commonly studied to better understand how amylin-related pathways interact with broader neuroendocrine and metabolic signaling systems.

Log in or sign up to get notified when this product becomes available.

Log In / Sign Up

General info
Brand

NOVERA COMPOUNDS

Strength

5mg

CAS

1415456-99-3

Chemical Formula

C₁₉₄H₃₁₂N₅₄O₅₉S₂

Molecular weight

4409 g/mol

Peptide Sequence

XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Synonyms

NN0174-0833, AM833, EX-A10092

Storage

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Shelf life

24 months from the manufacturing date.

What Are the Purporte Benefits of Cagrilintide (5mg)?

Cagrilintide (5mg), also known as NN0174-0833, AM833, and EX-A10092, is a long-acting amylin analogue that has been examined in preclinical and translational research models for its interactions with amylin and calcitonin receptors. These receptor systems are involved in physiological pathways governing gastric motility, appetite signaling, and energy regulation, making them of interest to metabolic research.

In non-clinical settings, cagrilintide has been studied for its effects on satiety signaling, gastric emptying kinetics, and modulation of metabolic pathways. These investigations examine how prolonged activation of the amylin receptor may influence feeding behavior and postprandial metabolic responses under controlled experimental conditions. No therapeutic benefit or clinical efficacy is implied.

What Is the Chemical Makeup of Cagrilintide (5mg)?

Cagrilintide (5mg) is a synthetic analogue of human amylin, consisting of 37 amino acids and engineered to enhance molecular stability and prolong systemic exposure. The peptide backbone is derived from the native human amylin sequence, with strategically placed amino acid modifications and lipid conjugation to reduce aggregation and enzymatic degradation.

Rather than isolated point substitutions, cagrilintide’s design incorporates sequence optimization and N-terminal lipidation, distinguishing it from native amylin and earlier analogues.

Other Specifications

  • Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
  • Molecular Weight: 4409 g/mol
  • CAS Number: 1415456-99-3
  • Purity: ≥98% (verified by HPLC and mass spectrometry)
  • Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

The molecule includes lipidation via a γ-glutamic acid spacer linked to a C20 dicarboxylic fatty acid, a modification that significantly extends peptide stability and circulating half-life in experimental models when compared with native human amylin.

What Does Scientific Research Say About Cagrilintide (5mg)?

Cagrilintide (5mg) remains an investigational research compound. Scientific literature primarily focuses on:

  • Receptor binding and signaling profiles at amylin and calcitonin receptors
  • Pharmacokinetic behavior resulting from lipid conjugation
  • Effects on gastric motility and appetite-related signaling in non-clinical models
  • Tolerability and mechanistic outcomes observed under controlled experimental conditions

No claims regarding the treatment, prevention, or management of disease have been established. Human clinical efficacy and long-term safety outcomes remain outside the scope of research-grade material descriptions.

What Are the Storage Conditions for Cagrilintide (5mg)?

Lyophilized Cagrilintide should be stored at –20°C or below, protected from light and moisture, to preserve structural integrity and analytical consistency. When stored under these conditions, the lyophilized peptide is generally stable for 1–2 years.

Once reconstituted for research use, solutions should be stored at 2–8°C and may be used for up to 4 weeks, provided sterile handling conditions are maintained. Reconstituted solutions should not be frozen, as repeated freeze–thaw cycles may lead to peptide aggregation, precipitation, and degradation.

For storage beyond the recommended post-reconstitution period, the peptide should remain in lyophilized form at –20°C or lower. Proper storage and handling are essential to ensure consistency and reliability in experimental applications.

Are you looking to buy Cagrilintide (5mg) online?

If you’re looking to order Cagrilintide (5mg) online at wholesale prices, contact Medical Spa RX for guidance on how to do so.

This product is supplied strictly for laboratory research use only and is not approved for human or veterinary administration. It is not intended for diagnostic, therapeutic, or clinical applications. Any reference to biological activity or potential effects is based solely on preclinical or in vitro findings and should not be interpreted as validated clinical outcomes. 

Researchers are responsible for ensuring proper handling, storage, and disposal in accordance with institutional, federal, and international guidelines. By purchasing or using this material, the buyer confirms that they are a qualified researcher and that the product will be used exclusively in controlled research settings compliant with all applicable regulations.

Sources

https://pubs.acs.org/doi/10.1021/acs.jmedchem.1c00565

https://www.nejm.org/doi/full/10.1056/NEJMoa2502081

https://www.thelancet.com/journals/lancet/article/PIIS0140-6736(23)01163-7/abstract

https://pmc.ncbi.nlm.nih.gov/articles/PMC8085567

https://pubmed.ncbi.nlm.nih.gov/34798060

All clinical and product claims on this page have been checked against peer-reviewed research, manufacturer data, and regulatory sources in accordance with our Editorial Policy .