99%+ Purity Guarantee
Undergoes independent third-party verification before release. Tested to confirm ≥99% purity.
Buy Cagrilintide (5mg) Online
Cagrilintide is a synthetic, long-acting amylin receptor agonist under investigation for its effects on appetite regulation and energy metabolism. Research suggests that it may modulate satiety signaling and gastric motility by activating amylin receptors in central and peripheral tissues, supporting investigations of feeding behavior, energy balance, and metabolic homeostasis pathways.
Log in or sign up to get notified when this product becomes available.
Log In / Sign Up
General info
| Brand | NOVERA COMPOUNDS |
|---|---|
| Strength | 5mg |
| CAS | 1415456-99-3 |
| Chemical Formula | C₁₉₄H₃₁₂N₅₄O₅₉S₂ |
| Molecular weight | 4409 g/mol |
| Peptide Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Synonyms | NN0174-0833, AM833, EX-A10092 |
| Storage | Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light. |
Disclaimer: Sold as a research-grade lyophilized peptide in dry powder form. Requires reconstitution under controlled laboratory conditions. Reconstitution agents are not included.
For Research Use Only (RUO): Not for human or animal use, consumption, injection, or application. Not for diagnostic, therapeutic, or clinical purposes.
Free Shipping Over $1000
With fast order dispatch
Guaranteed Product Authenticity
All products contain original LOT numbers
Secure SSL
Encryption
Your data is safe with us
No Order
Minimum
Get the exact quantity you need.
Why Novera Compounds?
Advanced synthesis techniques ensure high structural fidelity and ≥99% purity.
Independent laboratories confirm identity, purity, and batch consistency.
Designed for reproducible laboratory and analytical applications.
Products meet Research Use Only (RUO) standards and relevant laboratory regulations.
Certificates of Analysis and quality verification reports provided for every lot.
