99%+ Purity Guarantee

Undergoes independent third-party verification before release. Tested to confirm ≥99% purity.

Peptide Calculator

Calculate precise peptide reconstitution values.

Buy Cagrilintide 5mg+Semaglutide 5mg Online

Cagrilintide 5mg + Semaglutide 5mg is a dual-peptide research combination studied for complementary metabolic signaling. Research suggests that this combination may modulate appetite suppression and glucose regulation by simultaneously activating amylin and GLP-1 receptors, supporting investigations into dual-pathway satiety mechanisms and integrated energy metabolism control.

$119.00

General info
Brand

NOVERA COMPOUNDS

Strength

10mg

CAS

Cagrilintide: 1415456-99-3 Semaglutide: 910463-68-2

Chemical Formula

Cagrilintide: C₁₉₄H₃₁₂N₅₄₀₅₉₅S₂ Semaglutide: C₁₈₇H₂₉₁N₄₅O₅₉

Molecular weight

Cagrilintide:4409 g/mol Semaglutide: 4114 g/mol

Peptide Sequence

Cagrilintide: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Semaglutide: H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-OH

Synonyms

CagriSema

Storage

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Shelf life

24 months from the manufacturing date.

Disclaimer: Sold as a research-grade lyophilized peptide in dry powder form. Requires reconstitution under controlled laboratory conditions. Reconstitution agents are not included.

For Research Use Only (RUO): Not for human or animal use, consumption, injection, or application. Not for diagnostic, therapeutic, or clinical purposes.

Free Shipping Over $1000

With fast order dispatch

Guaranteed Product Authenticity

All products contain original LOT numbers

Secure SSL
Encryption

Your data is safe with us

No Order
Minimum

Get the exact quantity you need.

Why Novera Compounds?

Advanced synthesis techniques ensure high structural fidelity and ≥99% purity.

Independent laboratories confirm identity, purity, and batch consistency.

Designed for reproducible laboratory and analytical applications.

Products meet Research Use Only (RUO) standards and relevant laboratory regulations.

Certificates of Analysis and quality verification reports provided for every lot.

555a76c773c8ed79615174887299fb4c5c66d2ad

 

Cagrilintide 5mg + Semaglutide 5mg About This Product

Cagrilintide 5mg + Semaglutide 5mg is a research-grade dual-peptide formulation designed for laboratory investigation of metabolic regulation. The combination contains 5mg of cagrilintide, a synthetic 37-amino acid amylin receptor agonist, and 5mg of semaglutide for research, a modified glucagon-like peptide-1 (GLP-1) receptor agonist derived from human GLP-1.

Each component has been independently studied for its proposed role in appetite regulation, glucose control, and gastric motility. Furthermore, the formulation is provided as lyophilized powder in sterile, sealed vials at research-grade purity, designed for laboratory handling and preclinical model development.

This combination has been investigated in Phase 3 clinical research for its proposed dual-pathway modulation involving amylin and incretin systems.

Cagrilintide 5mg + Semaglutide 5mg Key Features and Benefits

  • Dual-Peptide Research Formulation — Cagrilintide 5mg + Semaglutide 5mg combination for investigating amylin and GLP-1 receptor signaling in metabolic research
  • Research-Grade Purity — Lyophilized powder verified for composition using high-performance liquid chromatography (HPLC) and mass spectrometry (MS), confirmed ≥98% purity
  • Convenient Laboratory Format — Provided in sterile vials requiring reconstitution with appropriate diluent for use in preclinical research protocols
  • Complementary Mechanisms — Each peptide operates through distinct receptor pathways, allowing researchers to investigate dual-pathway effects on metabolism and appetite regulation
  • Observed Research Applications — Suitable for in vitro cell culture systems, ex vivo tissue models, and animal studies examining coordinated metabolic responses
  • Stable Storage Profile — Lyophilized format maintains peptide stability under standard refrigeration conditions with documented shelf-life
  • Clinical Trial Documentation — Formulation composition matches specifications used in Phase 3 REDEFINE clinical trials
  • For Laboratory Research Use Only — Intended exclusively for regulated research environments and qualified investigators conducting preclinical studies

Cagrilintide 5mg + Semaglutide 5mg Mechanism & Research Applications

The cagrilintide semaglutide combo has been investigated for dual engagement of amylin and GLP-1 signaling pathways. Cagrilintide is an amylin receptor agonist that has been studied for its proposed role in satiety signaling and gastric emptying regulation in appetite control research. Semaglutide is a GLP-1 receptor agonist that has been studied for stimulating glucose-dependent insulin secretion and modulating central appetite regulation pathways.

In Phase 3 clinical research, this combination has been examined for coordinated effects on appetite regulation, glucose metabolism, and metabolic balance. The formulation has been investigated in studies of obesity-related physiology and metabolic dysfunction involving appetite regulation, gastric motility, and postprandial glucose control. Researchers have used this combination to explore how parallel modulation of amylin and GLP-1 receptors may influence metabolic outcomes.

The dual mechanism allows investigation of complementary signaling effects in metabolic systems without requiring separate administration protocols.

Cagrilintide 5mg + Semaglutide 5mg Dosing & Observed Effects in Research

In Phase 3 clinical trials (REDEFINE 1 and REDEFINE 2), the cagrilintide and semaglutide combination was administered once weekly via subcutaneous injection, with dose escalation targeting 2.4 mg of each peptide weekly over a 68-week trial duration.

Observed Effects in Phase 3 Clinical Trials:

REDEFINE 1 Trial (3,417 participants without type 2 diabetes)

  • Mean body weight reduction: 22.7% with combination therapy
  • Achievement of ≥5% body weight reduction: 91.9% (vs. 31.5% placebo)
  • Achievement of ≥20% body weight reduction: >60% of participants
  • Achievement of ≥30% body weight reduction: >20% of participants
  • Improvements noted in body composition, waist circumference, and BMI

REDEFINE 2 Trial (1,206 participants with type 2 diabetes)

  • Mean body weight reduction: 13.7% with combination therapy (vs. 3.4% placebo)
  • Glycated hemoglobin (HbA1c) control: 74% achieved HbA1c ≤6.5%
  • Low incidence of hypoglycemia reported (two severe events in patients on concomitant sulfonylurea therapy)
  • Improvements in cardiometabolic parameters

Gastrointestinal Observations

  • Gastrointestinal adverse events (nausea, vomiting, diarrhea) reported as mostly mild to moderate
  • Injection-site reactions observed in approximately 12% of combination therapy participants (17% with cagrilintide monotherapy)

Notably, these observations derive from Phase 3 human clinical trials with thousands of participants. The 5mg vial formulation described here is designed for preclinical laboratory research and is not intended to replicate therapeutic dosing. The clinical trials used 2.4 mg doses, not the 5mg per peptide in this research vial.

Cagrilintide 5mg + Semaglutide 5mg Storage, Safety & References

Storage Instructions: Store lyophilized vials at 2–8°C, protected from light, in the original packaging. Reconstitute using sterile diluent at neutral pH (6.8–7.2) under aseptic conditions. Once reconstituted, maintain refrigeration at 2–8°C and avoid freeze-thaw cycles. Use within two weeks of reconstitution.

Laboratory Safety: Use standard laboratory safety practices, including sterile technique and appropriate personal protective equipment (PPE) during handling and reconstitution. Dispose of materials in accordance with institutional biosafety guidelines.

Regulatory Status: CagriSema (cagrilintide-semaglutide combination) NDA was submitted to the FDA in December 2025 for once-weekly treatment of overweight or obesity with weight-related comorbidities. Those who wish to buy semaglutide cagrilintide should know that FDA review is expected in 2026. Moreover, this product is not yet approved for therapeutic use.

References

https://pubmed.ncbi.nlm.nih.gov/40544433

https://pubmed.ncbi.nlm.nih.gov/37364590

https://www.nature.com/articles/s41467-025-58680-y

https://pubmed.ncbi.nlm.nih.gov/34289354

https://pubmed.ncbi.nlm.nih.gov/34288673

https://www.acc.org/Latest-in-Cardiology/Journal-Scans/2025/07/02/14/43/REDEFINE-1-and-REDEFINE-2

https://www.novonordisk.com/content/nncorp/global/en/news-and-media/news-and-ir-materials/news-details.html?id=916470

Compliance Notice

This product is intended for laboratory research use only and is not approved for human or veterinary use.