99%+ Purity Guarantee

Undergoes independent third-party verification before release. Tested to confirm ≥99% purity.

Buy FOXO4 Online

FOXO4 is a synthetic peptide studied for its role in cellular senescence and aging-related signaling pathways. Research suggests that it may influence the regulation of senescent cell survival and stress-response mechanisms, primarily through modulation of FOXO transcription factor signaling involved in apoptosis, DNA repair, and cellular homeostasis.

$267.00

General info
Brand

NOVERA COMPOUNDS

Strength

10mg

CAS

2460055-10-9

Chemical Formula

C₂₂₈H₃₈₈N₈₆O₆₄

Molecular weight

5358.05 g/mol

Peptide Sequence

LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG

Synonyms

FOXO4-DRI

Storage

Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.

Disclaimer: Sold as a research-grade lyophilized peptide in dry powder form. Requires reconstitution under controlled laboratory conditions. Reconstitution agents are not included.

For Research Use Only (RUO): Not for human or animal use, consumption, injection, or application. Not for diagnostic, therapeutic, or clinical purposes.

Free Shipping Over $1000

With fast order dispatch

Guaranteed Product Authenticity

All products contain original LOT numbers

Secure SSL
Encryption

Your data is safe with us

No Order
Minimum

Get the exact quantity you need.

Why Novera Compounds?

Advanced synthesis techniques ensure high structural fidelity and ≥99% purity.

Independent laboratories confirm identity, purity, and batch consistency.

Designed for reproducible laboratory and analytical applications.

Products meet Research Use Only (RUO) standards and relevant laboratory regulations.

Certificates of Analysis and quality verification reports provided for every lot.

555a76c773c8ed79615174887299fb4c5c66d2ad

 

FOXO4 — About This Product

FOXO4 peptide is a synthetic version of the FOXO4 protein, which plays a role in managing cellular stress and longevity. It is made up of 46 amino acids in the D-form (the mirror image of natural amino acids) with a molecular weight of approximately 5.4 kDa (5,358 Da). This peptide is supplied as a lyophilized powder in a 10 mg vial, with a purity of ≥98%.

The FOXO4 peptide has been studied for its potential to regulate cellular senescence, DNA repair, and oxidative stress. Researchers use this peptide in laboratory settings to explore its role in aging, stress responses, and cell regeneration.

FOXO4 — Key Features and Benefits

  • High Purity: ≥98% purity, verified for reliable results.
  • Convenient Format: Lyophilized powder, provided in a 10 mg vial for easy reconstitution.
  • Research Focus: Investigated for its role in aging, oxidative stress, and DNA repair.
  • Laboratory-Ready: Suitable for in vitro and ex-vivo studies, compatible with various research protocols.

FOXO4 — Mechanism & Research Applications

Experts use FOXO4 for research to study how it influences cellular processes related to aging, stress adaptation, and DNA repair. Researchers focus on its potential role in cell regeneration and senescence (when damaged cells stop dividing), which could help understand aging and tissue health.

It has also been studied for its impact on oxidative stress and metabolic functions, particularly in how cells respond to damage. However, the findings are currently based on preclinical research, and human clinical trials are not available.

FOXO4 — Dosing & Observed Effects in Research

No clinical trials have been conducted for the FOXO4 peptide, so safe and effective human dosing has not been established. In preclinical research, doses ranged from 5–10 mg/kg body weight administered intravenously over a period of 5 days. In cell-based studies, typical concentrations used were 5–25 µM, but these do not translate to human dosing.

In animal models, FOXO4 can influence cellular behavior and stress-response pathways, though these findings are from research settings and do not imply therapeutic outcomes.

FOXO4 — Storage, Safety & References

  • Storage: Store FOXO4 peptide lyophilized at –20°C, away from light and moisture.
  • Reconstitution: After reconstitution with sterile, pyrogen-free solvent, store at 2–8°C and use within 5–7 days.
  • Handling: Use aseptic techniques and wear PPE (gloves, lab coat) during preparation and experimentation.
  • Safety: Avoid freeze-thaw cycles to preserve peptide integrity. Dispose of unused material according to local regulations.

References

https://pmc.ncbi.nlm.nih.gov/articles/PMC5556182

https://pmc.ncbi.nlm.nih.gov/articles/PMC8116695

https://pmc.ncbi.nlm.nih.gov/articles/PMC7053614

https://www.nature.com/articles/s41467-019-13931-7

https://onlinelibrary.wiley.com/doi/10.1111/jcmm.17333

Compliance Notice

This product is intended for laboratory research use only and is not approved for human or veterinary use.